PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00017.1_g00034.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 507aa    MW: 57525 Da    PI: 10.3012
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00017.1_g00034.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B360.43.1e-192199995
                             HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                       B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                               ++s+ l++p +f+++h +g k+e+kt++l++  s r+W+vk+  ++++    lt+GWkeF+ka++ ++gD+v+F+++g++ f  +v
  Rsa1.0_00017.1_g00034.1 21 TDFESH-LTIPATFFSKHiQG-KHEGKTVQLRSdASDRTWKVKM--EGHR----LTDGWKEFAKAHDFRVGDVVIFRHEGDMLF--HV 98
                             556677.***********644.56789*****97889*******..6666....***********************9998887..66 PP

                             E CS
                       B3 95 k 95
                             +
  Rsa1.0_00017.1_g00034.1 99 T 99
                             6 PP

2B3573.6e-18137231299
                              EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                       B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                              f++ ++ ++l++g + +p +fa+++g++k + + + l++++g++We +l  + +sg++++ ++W++F+ a +Lk+gD++ +kl + 
  Rsa1.0_00017.1_g00034.1 137 FSQSVTVSNLSRGAVGVPLDFASQNGLNKGR-RVIALRNQEGKTWESEL-KTTSSGQVFICRNWRSFCTASKLKVGDSFQLKLLQ- 219
                              57788999********************866.69***************.477777899999********************999. PP

                              SEE..EEEEE-S CS
                       B3  88 sefelvvkvfrk 99 
                              +++++v++++++
  Rsa1.0_00017.1_g00034.1 220 NKERPVFQLCSR 231
                              56669**99986 PP

3B354.91.6e-17253348199
                              EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                              f+k++ ++++l++g   lp +f+++++++   + +++l d++  +W++kl+ + +s  ++ +kGWk+F+ an++ +g++++++l++
  Rsa1.0_00017.1_g00034.1 253 FVKITPTASSLENGKQHLPVHFTRANKLNR--PGKIVLVDKDKVEWSMKLKADTRSMYIIGGKGWKSFCAANEVLAGESLTLELIR 336
                              88999999*******************995..558***************877777777778***********************9 PP

                              SSEE..EEEEE-S CS
                       B3  87 rsefelvvkvfrk 99 
                               +++ +v+k+++k
  Rsa1.0_00017.1_g00034.1 337 -RGRIPVLKFCSK 348
                              .555589999986 PP

4B352.49.9e-17366463199
                              EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE..EEE-TTHHHHHHHHT--TT-EEEEEE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr..yvltkGWkeFvkangLkegDfvvFkl 84 
                              f+k++t++++l+ gr  lp +f++ +++k   + +++l d+++ +W++kl+ + +sg+  ++ +kGWk+F+ an++ +g+ ++++l
  Rsa1.0_00017.1_g00034.1 366 FVKITTTASSLEIGRQHLPVHFTRGNKLKR--PGKIVLVDKDNVEWSMKLNEDIRSGTmyIMGGKGWKSFCAANEVVVGEPLTLEL 449
                              89************************9995..558***************88777766545556********************** PP

                              -SSSEE..EEEEE-S CS
                       B3  85 dgrsefelvvkvfrk 99 
                              ++r ++ +++k+++k
  Rsa1.0_00017.1_g00034.1 450 IRR-GRIPFLKFCSK 463
                              995.55588888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.9E-248105IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-2210110IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.33812104IPR003340B3 DNA binding domain
CDDcd100171.06E-1713101No hitNo description
SMARTSM010193.8E-2315104IPR003340B3 DNA binding domain
PfamPF023625.3E-132395IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-17129230IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-18132232IPR015300DNA-binding pseudobarrel domain
CDDcd100172.05E-13136230No hitNo description
PROSITE profilePS5086312.731136231IPR003340B3 DNA binding domain
SMARTSM010195.3E-20137232IPR003340B3 DNA binding domain
PfamPF023626.8E-18137231IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.5E-18247348IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-17248347IPR015300DNA-binding pseudobarrel domain
CDDcd100177.70E-15251347No hitNo description
SMARTSM010193.8E-27253349IPR003340B3 DNA binding domain
PROSITE profilePS5086313.874253348IPR003340B3 DNA binding domain
PfamPF023628.3E-17253348IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.9E-15362463IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-16362467IPR015300DNA-binding pseudobarrel domain
CDDcd100176.61E-16364462No hitNo description
SMARTSM010192.5E-26366464IPR003340B3 DNA binding domain
PROSITE profilePS5086313.437366463IPR003340B3 DNA binding domain
PfamPF023626.2E-16366463IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MENNESLFSP ANPHFFQPLL TDFESHLTIP ATFFSKHIQG KHEGKTVQLR SDASDRTWKV  60
KMEGHRLTDG WKEFAKAHDF RVGDVVIFRH EGDMLFHVTP FGTSFCEIQY VYSASHYKYK  120
EESDVIGEES SSKLTCFSQS VTVSNLSRGA VGVPLDFASQ NGLNKGRRVI ALRNQEGKTW  180
ESELKTTSSG QVFICRNWRS FCTASKLKVG DSFQLKLLQN KERPVFQLCS RLKGRPKKET  240
LSEEGDKTEN PRFVKITPTA SSLENGKQHL PVHFTRANKL NRPGKIVLVD KDKVEWSMKL  300
KADTRSMYII GGKGWKSFCA ANEVLAGESL TLELIRRGRI PVLKFCSKVK KETLTEEDNL  360
GETPRFVKIT TTASSLEIGR QHLPVHFTRG NKLKRPGKIV LVDKDNVEWS MKLNEDIRSG  420
TMYIMGGKGW KSFCAANEVV VGEPLTLELI RRGRIPFLKF CSKMEQPPFK TKAGGRKRTR  480
VQRLSQESRS KHDVSNQEAK VKTECLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892171e-100AC189217.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB010F06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013650511.10.0PREDICTED: B3 domain-containing protein REM8-like
SwissprotQ8H2D11e-140REM8_ARATH; B3 domain-containing protein REM8
TrEMBLA0A078BVB30.0A0A078BVB3_BRANA; BnaC01g06820D protein
TrEMBLA0A0D3A2T30.0A0A0D3A2T3_BRAOL; Uncharacterized protein
STRINGscaffold_701042.11e-138(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.11e-141B3 family protein